DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and acyp1

DIOPT Version :9

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_001016160.1 Gene:acyp1 / 548914 XenbaseID:XB-GENE-5909301 Length:98 Species:Xenopus tropicalis


Alignment Length:93 Identity:41/93 - (44%)
Similarity:54/93 - (58%) Gaps:0/93 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNI 70
            |:..|..:|:||:||||..||.|:.......:.|||.|||.|||.|||:|...||..::.||...
 Frog     4 EEPISVDYEVFGKVQGVFFRKYTQAEGNRLGLVGWVRNTDTGTVTGQLQGPSEKVREMQIWLQKK 68

  Fly    71 GSPRSIIERAEFTPTKEITSHNFSRFSI 98
            |||:|.|.:|:|...:.|.....|.|||
 Frog    69 GSPKSRITKAQFQNERRIKKLEHSTFSI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 40/89 (45%)
acyp1NP_001016160.1 Acylphosphatase 9..96 CDD:376373 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 94 1.000 Inparanoid score I4926
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm9551
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4463
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.