DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and Acyp1

DIOPT Version :9

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:XP_017449587.1 Gene:Acyp1 / 299203 RGDID:1311327 Length:157 Species:Rattus norvegicus


Alignment Length:97 Identity:41/97 - (42%)
Similarity:60/97 - (61%) Gaps:0/97 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 MQPAEQIFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFW 66
            |...:.:.|..:|:||:||||..||.|:.......:.|||.||:.|||:|||:|.:.||..::.|
  Rat    59 MAEGDTLVSVDYEIFGKVQGVFFRKYTQAEGKKLGLVGWVQNTNRGTVQGQLQGPVSKVRFMQEW 123

  Fly    67 LLNIGSPRSIIERAEFTPTKEITSHNFSRFSI 98
            |...|||:|.|:||.|...|.|::.::|.|.|
  Rat   124 LEKRGSPKSHIDRANFNNEKIISNLDYSDFQI 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 40/89 (45%)
Acyp1XP_017449587.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.