powered by:
Protein Alignment CG18371 and pad-1
DIOPT Version :9
Sequence 1: | NP_610923.1 |
Gene: | CG18371 / 36556 |
FlyBaseID: | FBgn0033893 |
Length: | 110 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493252.3 |
Gene: | pad-1 / 173156 |
WormBaseID: | WBGene00003905 |
Length: | 2417 |
Species: | Caenorhabditis elegans |
Alignment Length: | 69 |
Identity: | 19/69 - (27%) |
Similarity: | 29/69 - (42%) |
Gaps: | 17/69 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 ELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNIGSPRSIIE 78
:|..|...|.|| ||::...::..|::|. .|..|| :.| |::|.|...||
Worm 274 QLLRRCLFVVLR---RDMSLNRRLYTWLINR-SGETKG-VSG------------LSLGGPDDGIE 321
Fly 79 RAEF 82
...|
Worm 322 LTFF 325
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.