DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18371 and pad-1

DIOPT Version :9

Sequence 1:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster
Sequence 2:NP_493252.3 Gene:pad-1 / 173156 WormBaseID:WBGene00003905 Length:2417 Species:Caenorhabditis elegans


Alignment Length:69 Identity:19/69 - (27%)
Similarity:29/69 - (42%) Gaps:17/69 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNIGSPRSIIE 78
            :|..|...|.||   ||::...::..|::|. .|..|| :.|            |::|.|...||
 Worm   274 QLLRRCLFVVLR---RDMSLNRRLYTWLINR-SGETKG-VSG------------LSLGGPDDGIE 321

  Fly    79 RAEF 82
            ...|
 Worm   322 LTFF 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18371NP_610923.1 Acylphosphatase 10..99 CDD:279097 19/69 (28%)
pad-1NP_493252.3 Dopey_N 18..300 CDD:282036 8/28 (29%)
Dopey_N <2053..2373 CDD:296427
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.