DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Tspear and clos

DIOPT Version :9

Sequence 1:XP_038955104.1 Gene:Tspear / 365546 RGDID:1563108 Length:622 Species:Rattus norvegicus
Sequence 2:NP_001097246.3 Gene:clos / 5740204 FlyBaseID:FBgn0261016 Length:1836 Species:Drosophila melanogaster


Alignment Length:429 Identity:95/429 - (22%)
Similarity:162/429 - (37%) Gaps:143/429 - (33%)


- Green bases have known domain annotations that are detailed below.


  Rat   281 LGIEVFNIPGVGLFAAAANRKARS----AIYKWSDGKFVSYQ---NIATHQAQSWRHFTIGKKIF 338
            |.|.:..:|.| .:|.|.::.|..    |:|.|...: ..||   .:.|.:|.:........:.:
  Fly    75 LDICILQLPTV-KYATALHKNAAGVRHFAVYTWRPAE-QDYQLLVELETPKAVALDCLAFAGRGY 137

  Rat   339 LAVA-NF-GPNERGQEFSVIYKWSP----RKLKF------------------TL----------- 368
            :||: |. .|..:.:|.|.||:.||    |.:::                  ||           
  Fly   138 VAVSYNLTEPVSQAREGSPIYEISPETGIRTVQYFSGTHLRGMYLRISSQELTLLHAFESNAQCP 202

  Rat   369 --------YQRI-ATH--SARDWEAFEVDGEHFLVVANHREGDNHN-IDSVVYRWNPSSQLFEAN 421
                    :||: |.|  .||..|||.:|...::.|||:.:.:... ..|.::||:..||.|:..
  Fly   203 YFKWMGKSFQRLGAIHCSKARRMEAFGIDYTDYVAVANYADAEGRTATHSEIFRWDAKSQRFQLF 267

  Rat   422 QSIATSGAYDWEFFT-----VGPYSFLVVANTFNGTSTQV---HSHLYIWLVGAFQLFQSFLTFG 478
            |.:.::||.|.::|:     |....||::.||..||..:|   .:.:|::..|.|..:|. |:|.
  Fly   268 QRLRSNGAVDVKYFSLPVNEVSRRHFLILGNTIGGTGAEVGDADTVIYVFEKGQFVPYQR-LSFY 331

  Rat   479 AAD--WEVFH-IGERIFLAVANSHSYDVQMQAQNDTYILSSVIYELNVTAQTFVKFQDIPTCSAL 540
            |.:  ..|.| |.|:..|.|| .:..||:             ||.||                  
  Fly   332 ALERVLPVQHSISEKFLLLVA-CNKQDVK-------------IYNLN------------------ 364

  Rat   541 DWEF---------------------FSVGEDHFLVVAN-SFDGNTFSVNSIIYRWQGYEGFVAVH 583
            ||.|                     :..|:..:||:|| :...|..::...:|:...:...:...
  Fly   365 DWRFEESKVQFTEGALSRGVARMRSYEEGDQSYLVIANENMAANETNIFQPLYKQDEHANILRQQ 429

  Rat   584 KLPTFGCRDWEAFNTTAGSYLIYSSAKEPLSRVLKLRTD 622
            .:      ||               |:|...|:.::..|
  Fly   430 II------DW---------------AREQRKRLEQMNLD 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TspearXP_038955104.1 LamG <23..175 CDD:419873
EPTP 313..358 CDD:397689 11/49 (22%)
EPTP 365..410 CDD:397689 16/85 (19%)
EPTP 418..454 CDD:397689 13/40 (33%)
EPTP 468..520 CDD:397689 15/54 (28%)
EPTP 528..572 CDD:397689 9/65 (14%)
closNP_001097246.3 EPTP 263..315 CDD:281697 14/51 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352850
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto97671
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR15261
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.