DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RN-tre and GAPsec

DIOPT Version :9

Sequence 1:NP_652381.1 Gene:RN-tre / 36554 FlyBaseID:FBgn0020620 Length:571 Species:Drosophila melanogaster
Sequence 2:NP_648245.2 Gene:GAPsec / 38987 FlyBaseID:FBgn0035916 Length:403 Species:Drosophila melanogaster


Alignment Length:265 Identity:52/265 - (19%)
Similarity:97/265 - (36%) Gaps:77/265 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 KLHKRVYKGIPDRVRMVAWNKLLDIQQSINNNAGVYLRMLQLARKYSTETRQIDADVNRQFRDNL 159
            :||:||...:              :..:.....|:.:..:.|..|.|.|              |.
  Fly   167 RLHERVVPAV--------------LSSANVERKGLGMTKINLITKRSVE--------------NY 203

  Fly   160 AFRE-----RYSVKQCSLFNVLNAYSIYNSELGYCQGMACVAGVL---------LLYLHEEEA-- 208
            |..|     .:.|.|..||    .|:..|...||.|||..:.|.:         |.|....||  
  Fly   204 AAMEEGQEAHWEVVQRILF----IYAKLNPGQGYVQGMNEIVGPIYYVMASDPDLTYRAHAEADC 264

  Fly   209 FWALNTLITDQKYGMHGLFI------EG-----FPKLTRFIDHHDRIMSKIMR--KLHKHFTKHN 260
            |:....|:::    :...||      ||     ..:|:..:...|..:.:::|  :||..:    
  Fly   265 FFCFTALMSE----IRDFFIKTLDDAEGGIKFMMARLSNMLKSKDLSIYELLRSQELHPQY---- 321

  Fly   261 VDALLYAIKWFFVVFVERVPFSLSLRVWDIFMLDGDR--VILSMAITILYLHKDELLRLKDMDAI 323
                 |:.:|..::..:..|....||:||....|..|  .::.:..:::.:.::.:|. .|..:.
  Fly   322 -----YSFRWLTLLLSQEFPLPDVLRIWDSVFADEQRFDFLIKICCSMILIQREAILE-NDFASN 380

  Fly   324 IEYLQ 328
            ::.||
  Fly   381 VKLLQ 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RN-treNP_652381.1 TBC 100..315 CDD:214540 45/245 (18%)
GAPsecNP_648245.2 TBC <191..373 CDD:214540 43/212 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456573
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5210
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22957
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.