DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Prmt6

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_849222.3 Gene:Prmt6 / 99890 MGIID:2139971 Length:378 Species:Mus musculus


Alignment Length:354 Identity:72/354 - (20%)
Similarity:124/354 - (35%) Gaps:122/354 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 KRLQKERAAL----SEDVGLYDYLKEEIGFRLADRV------FDIKREF-----KAAADIGCSRG 85
            :|.:.||..|    ..||.:::.:       :||:|      ..|.:.:     |...|:|...|
Mouse    40 RRTKSERDQLYYECYSDVSVHEEM-------IADQVRTEAYRLGILKNWAALRGKTVLDVGAGTG 97

  Fly    86 YLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVN 150
            .||.........::...:.|| :.:||:     ::|:|...|::                   |:
Mouse    98 ILSIFCAQAGARRVYAVEASA-IWQQAR-----EVVRLNGLEDR-------------------VH 137

  Fly   151 DLPGCFVRIKQSLKPDGVFIASMFGGDTLYE-LRSSLQLAELE--RKGGISPHISPFTQIRDIGS 212
            .|||....::...:.|.: ::...|...|:| :.||:..|..:  ::||:....|....:..|..
Mouse   138 VLPGPVETVELPERVDAI-VSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFVAPISD 201

  Fly   213 --LLNRAGF-------------------TMLTIDTDELVIGYPSMFELMWDLKGMAENNAAFNRP 256
              |..|.||                   |...:...|:|:         .||.|  |:..|  ||
Mouse   202 QMLEWRLGFWSQVKQHYGVDMSCMESFATRCLMGHSEIVV---------QDLSG--EDVLA--RP 253

  Fly   257 AHLSRETMLAASAIYQEL------------YAKPNEKGIPATFQIIYFVG--------------- 294
            ...: :..||.:.:.|||            |......|....||:.:..|               
Mouse   254 QRFA-QLELARAGLEQELEAGVGGRFRCSCYGSAPLHGFAVWFQVTFPGGDSEKPLVLSTSPFHP 317

  Fly   295 ---WKPG---PNQPQPLERGT---GEVSL 314
               ||..   .|:|.|:|:.|   ||::|
Mouse   318 ATHWKQALLYLNEPVPVEQDTDISGEITL 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 56/302 (19%)
Methyltransf_11 79..170 CDD:285453 17/90 (19%)
Prmt6NP_849222.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..46 1/5 (20%)
Methyltransf_18 85..188 CDD:289607 26/128 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.