DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and PRMT9

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_612373.2 Gene:PRMT9 / 90826 HGNCID:25099 Length:845 Species:Homo sapiens


Alignment Length:289 Identity:58/289 - (20%)
Similarity:99/289 - (34%) Gaps:81/289 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLTKLSTLKVKCELRALSSLTQTSQHIFDRNAKRLQKERAAL---------------SEDVGLYD 53
            ::..:|.|.::||:....|.||....:...|...|....|.|               |.::.|.:
Human   465 RIQSISVLGLECEMDVAKSFTQNKDLLSLGNEAELCSALANLQTSKPDAVEQTCILESTEIALLN 529

  Fly    54 YLKEEIGFRLA-DRVFD--IKREFKAAADIGC----SRGYLSRHILAESVEQLTLTDTSA--TML 109
            .:....||::| .:|..  ...:.....|..|    |.|....:.:...:|...:.|.|.  ::|
Human   530 NIPYHEGFKMAMSKVLSSLTPEKLYQTMDTHCQNEMSSGTGQSNTVQNILEPFYVLDVSEGFSVL 594

  Fly   110 EQAQGTPGLKMVK----LVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLK------ 164
            ....||.|  .||    :.||:.::     :|||:..:      |..|      |::|:      
Human   595 PVIAGTLG--QVKPYSSVEKDQHRI-----ALDLISEA------NHFP------KETLEFWLRHV 640

  Fly   165 PDGVFIASMFGGDTLYEL-------RSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTML 222
            .|...:......|.|:.:       .|.|...|:..|..||            ..||...|    
Human   641 EDESAMLQRPKSDKLWSIIILDVIEPSGLIQQEIMEKAAIS------------RCLLQSGG---- 689

  Fly   223 TIDTDELVIGYPSMFELMWDLKGMAENNA 251
                 ::...|..||.|:.:.:.:.|.||
Human   690 -----KIFPQYVLMFGLLVESQTLLEENA 713

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 45/220 (20%)
Methyltransf_11 79..170 CDD:285453 23/106 (22%)
PRMT9NP_612373.2 TPR 1 25..58
TPR <39..144 CDD:223533
TPR 2 67..100
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
TPR 3 101..134
AdoMet_MTases 148..>303 CDD:327401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.