DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Prmt3

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_446009.1 Gene:Prmt3 / 89820 RGDID:620413 Length:528 Species:Rattus norvegicus


Alignment Length:390 Identity:82/390 - (21%)
Similarity:143/390 - (36%) Gaps:124/390 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELRALSSLTQTSQHIFDRNAKRLQKER---------------------AALSEDV-GLY--DY-- 54
            |.||||     ::....|..:.|||.:                     |.|.||. |:|  .|  
  Rat   164 EARALS-----AEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGH 223

  Fly    55 --LKEEIGFRLADRV-FDIKREF----------KAAADIGCSRGYLSRHILAESVEQLTLTDTSA 106
              :.||:   |.|:| .:..|:|          |...|:||..|.||........:::...|.| 
  Rat   224 YGIHEEM---LKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQS- 284

  Fly   107 TMLEQAQGTPGLKMVK----LVKDE-EQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPD 166
            .:|.||.....|..::    |:|.: |::......:|::||    .|:    |.|:..:..|  |
  Rat   285 EILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIIS----EWM----GYFLLFESML--D 339

  Fly   167 GVFIASMFGGDTLYELRSSLQLAELERKGG-ISPHISPFT--QIRDIGSLLNRA-------GFTM 221
            .|..|            .|..||    ||| :.|.|...:  .:.|:....:|.       ||.|
  Rat   340 SVLYA------------KSKYLA----KGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNM 388

  Fly   222 LTIDTDEL------VIGYPSMFELMWDLK-------GMAENNAAFNRPAHLSRETMLAASAIYQE 273
            ..:....:      |:.:.::.....|:|       .:::...:.:.....::..|..|.|.|.:
  Rat   389 SCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFD 453

  Fly   274 LYAKPNEKGIPATFQIIYFVG-------WKPG---PNQPQPLERG---TGEVSL----KDLGSII 321
            :|.:.|     ...::::..|       ||..   ..:|.|::.|   .|::::    ||..|:|
  Rat   454 IYFEKN-----CHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLI 513

  Fly   322  321
              Rat   514  513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 55/283 (19%)
Methyltransf_11 79..170 CDD:285453 24/95 (25%)
Prmt3NP_446009.1 zf-C2H2_2 48..>97 CDD:289522
AdoMet_MTases 256..356 CDD:100107 31/126 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.