DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and TMT1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_011102.3 Gene:TMT1 / 856922 SGDID:S000000977 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:190 Identity:43/190 - (22%)
Similarity:73/190 - (38%) Gaps:40/190 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILAE-- 94
            |.|::|....|.:...|.           :::.|...|.:|  |...|:||..|..:..:..|  
Yeast     8 DFNSERYSSSRPSYPSDF-----------YKMIDEYHDGER--KLLVDVGCGPGTATLQMAQELK 59

  Fly    95 SVEQLTLTDTSATMLEQA----QGTPGLKMVKLVKDEEQLDF--------EDNSLDLVISSLSLH 147
            ..||:..:|.||||::.|    :|:|........|.....||        :...:|::.:....|
Yeast    60 PFEQIIGSDLSATMIKTAEVIKEGSPDTYKNVSFKISSSDDFKFLGADSVDKQKIDMITAVECAH 124

  Fly   148 WVNDLPGCFVRIKQS----LKPDGVFIASMFGGDTL---YELRSSLQLAELERKGGISPH 200
            |.:     |.:.::|    |:.||. ||.....|.:   |.....|.:.....|.|:.|:
Yeast   125 WFD-----FEKFQRSAYANLRKDGT-IAIWGYADPIFPDYPEFDDLMIEVPYGKQGLGPY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 38/164 (23%)
Methyltransf_11 79..170 CDD:285453 26/108 (24%)
TMT1NP_011102.3 AdoMet_MTases 33..>147 CDD:418430 30/121 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.