DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and ERG6

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_013706.1 Gene:ERG6 / 855003 SGDID:S000004467 Length:383 Species:Saccharomyces cerevisiae


Alignment Length:294 Identity:64/294 - (21%)
Similarity:104/294 - (35%) Gaps:85/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 YLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHI-----------------LAES---VEQ 98
            ||..:.|.:..|.|.          |:||..|..:|.|                 :|::   .::
Yeast   110 YLAYKAGIQRGDLVL----------DVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKK 164

  Fly    99 LTLTDTSATMLEQAQGTPGLKMVKLVK-DEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQS 162
            ..|:|                .:..|| |..::|||:|:.|.|.:..:......|.|.:..|.:.
Yeast   165 YNLSD----------------QMDFVKGDFMKMDFEENTFDKVYAIEATCHAPKLEGVYSEIYKV 213

  Fly   163 LKPDGVFIASMFGGDTLYELRS--SLQLA-ELERKGGISP--HISPFTQIRDIG-SLLNRAGFTM 221
            |||.|.|....:.....|:..:  ..::| |:|...||..  |:       |:. ..|...||.:
Yeast   214 LKPGGTFAVYEWVMTDKYDENNPEHRKIAYEIELGDGIPKMFHV-------DVARKALKNCGFEV 271

  Fly   222 LTID-----TDELVIGYPSMFELMWDLKGMAENNAAFNRPAHLSRETMLAASAIYQELYAKP-NE 280
            |..:     .||:...||...|  |.......|.|.|.|.::|.|:...|...:.::|...| ..
Yeast   272 LVSEDLADNDDEIPWYYPLTGE--WKYVQNLANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGS 334

  Fly   281 KGIPATFQ-----------------IIYFVGWKP 297
            |.:.|..:                 ::.||..||
Yeast   335 KEVTAALENAAVGLVAGGKSKLFTPMMLFVARKP 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 60/287 (21%)
Methyltransf_11 79..170 CDD:285453 25/111 (23%)
ERG6NP_013706.1 Cfa 66..>277 CDD:225139 43/199 (22%)
Methyltransf_11 124..222 CDD:400514 26/123 (21%)
Sterol_MT_C 306..368 CDD:400686 11/61 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.