DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and OMS1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_010602.3 Gene:OMS1 / 851911 SGDID:S000002724 Length:471 Species:Saccharomyces cerevisiae


Alignment Length:201 Identity:38/201 - (18%)
Similarity:70/201 - (34%) Gaps:36/201 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLTKLSTLKV----KCELRALSSLTQTSQHIFDRNAKRLQKERAALSEDVGLYDYLKEEI--GFR 62
            ||.:...||:    |.:...:.:........||:|  :|.::.....:....|.....|.  ...
Yeast   160 KLRRRDELKLEEYKKMQEEGIENFDDIRVQNFDQN--KLNEQILPARDTTNFYQEKANEYDKAIN 222

  Fly    63 LADRVFDIKREFK--------AAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA-----QG 114
            :.:||..:.:..|        ...::.|..|...:::....:..:|..|:|..|:|..     :.
Yeast   223 MEERVIFLGKRRKWLMKHCQGDVLEVSCGTGRNIKYLDMSRINSITFLDSSENMMEITHKKFREK 287

  Fly   115 TPGLKMVKLV--KDEEQLDF-----------EDNSL--DLVISSLSLHWVNDLPGCFVRIKQSLK 164
            .|..|.|..|  |.|..:|.           ::|.:  |.::.:..|....|.........:.||
Yeast   288 FPKYKKVAFVVGKAENLVDLAEKGKPSLENEKENQVKYDTIVEAFGLCSHEDPVKALNNFGKLLK 352

  Fly   165 PDGVFI 170
            |||..|
Yeast   353 PDGRII 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 28/143 (20%)
Methyltransf_11 79..170 CDD:285453 23/110 (21%)
OMS1NP_010602.3 Methyltransf_25 245..355 CDD:404528 21/109 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.