DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Mettl27

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006504585.1 Gene:Mettl27 / 79565 MGIID:1933146 Length:266 Species:Mus musculus


Alignment Length:209 Identity:46/209 - (22%)
Similarity:65/209 - (31%) Gaps:48/209 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 EDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQ 111
            :||....|....:......|.|..........|:.|..|.::..:.|....|:...|.|..||:|
Mouse    41 QDVAALKYRAPRLAVDCLSRAFRGSPHDALILDVACGTGLVAVELQARGFLQVQGVDGSPEMLKQ 105

  Fly   112 AQGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGG 176
            |:.. ||                      ...|||        |.:..:....|:|.|.|.:..|
Mouse   106 ARAR-GL----------------------YHHLSL--------CTLGQEPLPDPEGTFDAVIIVG 139

  Fly   177 DTLYELRSSLQLAELER--KGGISPHISPFTQIRDIG---------SLL--NRAGFTMLTIDTDE 228
            ...........:.||.|  |.|..||.:..|    :|         |.|  :|.|...||..|:.
Mouse   140 ALSEGQVPCSAIPELLRVTKPGSCPHQTTVT----VGYSHDREAFASALVPDRGGLVCLTTRTNP 200

  Fly   229 LVIGYPSMFELMWD 242
            ..:.|....|...|
Mouse   201 SNLPYKETLEATLD 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 43/198 (22%)
Methyltransf_11 79..170 CDD:285453 19/90 (21%)
Mettl27XP_006504585.1 AdoMet_MTases 31..>103 CDD:388410 12/61 (20%)
Methyltransf_25 71..161 CDD:379312 26/120 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.