DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Mettl7a1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_081610.2 Gene:Mettl7a1 / 70152 MGIID:1916523 Length:244 Species:Mus musculus


Alignment Length:98 Identity:25/98 - (25%)
Similarity:36/98 - (36%) Gaps:35/98 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 TMLEQAQGT--------PGLK-------------MVKLVKDEEQLDFE--------------DNS 136
            |:||...||        ||.:             :.|.|.:..||.||              |.|
Mouse    73 TLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLFKSVAENRQLQFERFVVAAGEDMHQVTDGS 137

  Fly   137 LDLVISSLSLHWVNDLPGCFVRIKQSLKPDGVF 169
            :|:|:.:|.|..|.:.......:.:.|||.|.|
Mouse   138 VDVVVCTLVLCSVKNQEKILREVCRVLKPGGAF 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 25/98 (26%)
Methyltransf_11 79..170 CDD:285453 25/98 (26%)
Mettl7a1NP_081610.2 SmtA 70..>187 CDD:223574 25/98 (26%)
Methyltransf_11 75..172 CDD:285453 24/96 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.