DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Mettl27

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001102969.1 Gene:Mettl27 / 688407 RGDID:1588881 Length:253 Species:Rattus norvegicus


Alignment Length:124 Identity:27/124 - (21%)
Similarity:52/124 - (41%) Gaps:11/124 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGL--KMVKLVKDEEQLDFEDNSLD--L 139
            |:.|..|.::..:.|....|:...|.|..||:||:.. ||  .:......:|.|.:...:.|  :
  Rat    73 DVACGTGLVAVELQARGFLQVQGVDGSPEMLKQARAR-GLYHHLSLCTLGQEPLPYPKGTFDAVI 136

  Fly   140 VISSLSLHWVNDLP-GCFVRIKQSLKPDGVFIASMFGGDTLYELRSSLQLA--ELERKG 195
            ::.:||   ...:| .....:.:..||.|:...:.....:....:.:|:.|  .||:.|
  Rat   137 IVGALS---EGQVPCSAIPELLRVTKPGGLVCLTTRTNPSNLPYKEALEAALDSLEQAG 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 27/124 (22%)
Methyltransf_11 79..170 CDD:285453 22/95 (23%)
Mettl27NP_001102969.1 Methyltransf_25 71..162 CDD:404528 21/92 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.