DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG8067 and Atpsckmt

DIOPT Version :9

Sequence 1:	NP_001260960.1	Gene:	CG8067 / 36552	FlyBaseID:	FBgn0033891	Length:	333	Species:	Drosophila melanogaster
Sequence 2:	NP_080822.1	Gene:	Atpsckmt / 68073	MGIID:	1915323	Length:	247	Species:	Mus musculus

Alignment Length:	122	Identity:	25/122 - (20%)
Similarity:	52/122 - (42%)	Gaps:	25/122 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly    26 TSQHIFDRNAKRLQKERAALSEDVGLYD------YLKE---EIGFRLADRV--FDIKREFKAAAD 79
            ||:.:  .|..|:.:.|.....|:|..|      ..||   .:|:.|...:  :...|.::|...
Mouse    69 TSKQV--ENVVRMLRHRRGPLVDIGSGDGRIVIAAAKEGFPAVGYELNPWLVWYSRYRAWRAGVH 131

  Fly    80 IGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNS 136
             |.::.|:|      .:.::|....|..::   .|.|  :|:..::.:.:|:.||.:
Mouse   132 -GSAKFYIS------DLWKVTFAQYSNVVI---FGVP--QMMPQLEKKLELELEDGA 176

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG8067	NP_001260960.1	BioC	58..296	CDD:273953	15/81 (19%)
CG8067	NP_001260960.1	Methyltransf_11	79..170	CDD:285453	11/58 (19%)
Atpsckmt	NP_080822.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..25
		Required for mitochondrial location. /evidence=ECO:0000250\|UniProtKB:Q6P4H8	51..85		5/17 (29%)
		BchM-ChlM	<87..>157	CDD:273930	14/79 (18%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	209..247
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0500
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900