DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Bud23

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_030110611.1 Gene:Bud23 / 66138 MGIID:1913388 Length:300 Species:Mus musculus


Alignment Length:268 Identity:54/268 - (20%)
Similarity:85/268 - (31%) Gaps:115/268 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 KCELRALSSLTQTSQH------IFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKR 72
            :|....::|.::..:|      .:|:|..|               .|::.       .|:.||:.
Mouse    14 RCHTIEMASRSRRPEHSGPPELFYDQNEAR---------------KYVRN-------SRMIDIQT 56

  Fly    73 EFKAAA---------------DIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA---------- 112
            :....|               ||||..| ||...::|........|.|..||:.|          
Mouse    57 KMTERALELLCLPEGQPSYLLDIGCGSG-LSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLL 120

  Fly   113 -----QGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWV------NDLPG----CFVRIKQS 162
                 ||.|               |...|.|..||..::.|:      :|:|.    ||.     
Mouse   121 LGDMGQGVP---------------FRPGSFDGCISISAVQWLCNANKKSDVPARRLYCFF----- 165

  Fly   163 LKPDGVFIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTD 227
               ..::.|.:.|.      |:.|||         .|..|  .|:..|.:...||||      |.
Mouse   166 ---SSLYSALVRGA------RAVLQL---------YPENS--EQLELITTQATRAGF------TG 204

  Fly   228 ELVIGYPS 235
            .:|:.:|:
Mouse   205 GVVVDFPN 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 47/218 (22%)
Methyltransf_11 79..170 CDD:285453 26/115 (23%)
Bud23XP_030110611.1 UbiG 37..>110 CDD:225137 20/95 (21%)
Methyltransf_11 77..>147 CDD:369777 21/85 (25%)
WBS_methylT 223..298 CDD:372208
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.