DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and mettl7a.3

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001373576.1 Gene:mettl7a.3 / 569046 ZFINID:ZDB-GENE-120215-64 Length:242 Species:Danio rerio


Alignment Length:160 Identity:44/160 - (27%)
Similarity:62/160 - (38%) Gaps:46/160 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LSEDVGLYDYLKEEIGFRLADRVF------------DIKRE-------FKAA------ADIGCSR 84
            :.|.|||..:.|     ||..|:.            |.|||       |:.:      .::||..
Zfish    21 VGERVGLLSFYK-----RLYPRLLSSFTIAYNELMNDKKRELFLNLERFQPSKGSLRILEVGCGS 80

  Fly    85 GYLSRHILAESVEQLTLTDTS---ATMLEQAQGTPGLKMVKLVKDE------EQLD-FEDNSLDL 139
            |....|....|  ::|.||.:   .|.||::..    |...||.|.      |.|. .||:|:|.
Zfish    81 GANFEHYPTGS--KITCTDPNPHFKTYLEKSME----KNEHLVYDSFIVASGENLQAVEDSSVDA 139

  Fly   140 VISSLSLHWVNDLPGCFVRIKQSLKPDGVF 169
            |:.:|.|..|.|........|:.|:|.|.|
Zfish   140 VVCTLVLCTVKDTNKVLQEAKRVLRPGGAF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 39/147 (27%)
Methyltransf_11 79..170 CDD:285453 31/101 (31%)
mettl7a.3NP_001373576.1 Methyltransf_11 74..171 CDD:400514 31/102 (30%)
AsSugarArsM <132..>222 CDD:411681 14/38 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.