DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and zgc:162396

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001038247.2 Gene:zgc:162396 / 555292 ZFINID:ZDB-GENE-030131-1190 Length:271 Species:Danio rerio


Alignment Length:291 Identity:72/291 - (24%)
Similarity:119/291 - (40%) Gaps:60/291 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QKERAALSEDVGLY--DYLKEEIGFRLADRVFDIK--REFKAAADIGCSRGYLSRHILAESVEQL 99
            :|:.|:|.:.....  |.|||     |..:..|.|  :..:.|.|:||..|..||. |....:|:
Zfish     8 EKQHASLYQQYRFAPPDELKE-----LILQYLDKKKGKPHQLAVDLGCGTGQTSRP-LTPYFQQV 66

  Fly   100 TLTDTSATMLEQA---QGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQ 161
            ...|.|.:.:|:|   ||.|.|  ...|...|:|.|.|.|:||:.::.:.||.:  ...||:..|
Zfish    67 VGIDVSESQVEEARAVQGFPNL--TYRVGTAEELPFPDASVDLLTAASAAHWFD--AERFVKEAQ 127

  Fly   162 S-LKPDGVFIASMFG------------GDTL----YELRSSLQLAELERKGGISPHISPFTQIRD 209
            . |||.|..  ::||            ||.|    .||:..||.....:..|.|      |:::|
Zfish   128 RVLKPHGCL--ALFGYNDSMKIHHESCGDQLNIIYEELKQELQPYTSTKVTGAS------TKLKD 184

  Fly   210 IGSLLNRAGFTMLTIDTDELVIGYPSMFEL-MWDLKGMAENNAAFNRPAHLSRETMLA------- 266
            :        |.::.....|.:...|...:| :.::.|..:..:.:.  |:|......|       
Zfish   185 L--------FEVIPFPDKERIETIPIKEQLSVKNILGFFQTFSMYQ--AYLRANPKAATALLEKT 239

  Fly   267 ASAIYQELYAKPNEKGIPATFQIIYFVGWKP 297
            ||.|.:|:.|...:..:...::....:..||
Zfish   240 ASRILEEIKATSTDAKVDFMWEYYCVLACKP 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 63/267 (24%)
Methyltransf_11 79..170 CDD:285453 33/94 (35%)
zgc:162396NP_001038247.2 Methyltransf_11 46..138 CDD:285453 33/98 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.