DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Atpsckmt

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001102648.1 Gene:Atpsckmt / 499561 RGDID:1560629 Length:216 Species:Rattus norvegicus


Alignment Length:116 Identity:25/116 - (21%)
Similarity:46/116 - (39%) Gaps:38/116 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 GCFVRI---KQSLKPD--GVFIASMFGGD--TLYELRSSLQLAELERKGGISPHIS----PFT-- 205
            ||.:..   ..|||..  |..|..:.||.  |:|.:.:..          |:|.:.    ||.  
  Rat    14 GCVLPTSPESDSLKTSNWGFLITGVIGGALVTVYAVTTPF----------IAPALRKVCLPFVPA 68

  Fly   206 ---QIRDIGSLLNRAGFTMLTIDTDE--LVI-----GYPSM-FE----LMW 241
               |:.::..:|......::.|.:.:  :||     |:|:: :|    |:|
  Rat    69 TSRQVENVVKMLQHRRGPLVDIGSGDGRIVIAAAKAGFPAVGYELNPWLVW 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 25/116 (22%)
Methyltransf_11 79..170 CDD:285453 6/20 (30%)
AtpsckmtNP_001102648.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..25 2/10 (20%)
Required for mitochondrial location. /evidence=ECO:0000250|UniProtKB:Q6P4H8 51..85 6/43 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.