DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and prmt6

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001157460.2 Gene:prmt6 / 448867 ZFINID:ZDB-GENE-040914-7 Length:355 Species:Danio rerio


Alignment Length:203 Identity:47/203 - (23%)
Similarity:87/203 - (42%) Gaps:59/203 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSSLTQTSQHIFDRNAKRLQKERAALSEDVGLYD-----YLKEEIGFRLADRV---------FDI 70
            :::|.:.|||.    .|:.:.:|:  :||...:|     .:.||:   :||.|         |..
Zfish     1 MANLCKMSQHA----TKKRKLDRS--TEDYMYFDSYSDVTIHEEM---IADTVRTNTYRMGIFKN 56

  Fly    71 KR--EFKAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFE 133
            .:  |.|...|:|...|.||.........::...:.| ::.:||     :|:|||.:.|::::..
Zfish    57 SKSIEGKVVLDVGAGTGVLSLFCAQAGARKVYAVEAS-SIADQA-----VKIVKLNQMEDRIEVI 115

  Fly   134 DNSL---------DLVISS----LSLH--WVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLYELR 183
            .::|         |:::|.    ..||  .:|.:  .|.|.|. |||.|:.:.|          |
Zfish   116 KSTLETIELAEKVDVIVSEWMGYALLHESMLNSV--IFARDKW-LKPGGLILPS----------R 167

  Fly   184 SSLQLAEL 191
            :.|.:|.:
Zfish   168 ADLYIAPI 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 37/160 (23%)
Methyltransf_11 79..170 CDD:285453 26/105 (25%)
prmt6NP_001157460.2 AdoMet_MTases 50..>175 CDD:302624 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.