Sequence 1: | NP_001260960.1 | Gene: | CG8067 / 36552 | FlyBaseID: | FBgn0033891 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157460.2 | Gene: | prmt6 / 448867 | ZFINID: | ZDB-GENE-040914-7 | Length: | 355 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 47/203 - (23%) |
---|---|---|---|
Similarity: | 87/203 - (42%) | Gaps: | 59/203 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LSSLTQTSQHIFDRNAKRLQKERAALSEDVGLYD-----YLKEEIGFRLADRV---------FDI 70
Fly 71 KR--EFKAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFE 133
Fly 134 DNSL---------DLVISS----LSLH--WVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLYELR 183
Fly 184 SSLQLAEL 191 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8067 | NP_001260960.1 | BioC | 58..296 | CDD:273953 | 37/160 (23%) |
Methyltransf_11 | 79..170 | CDD:285453 | 26/105 (25%) | ||
prmt6 | NP_001157460.2 | AdoMet_MTases | 50..>175 | CDD:302624 | 33/143 (23%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |