Sequence 1: | NP_001260960.1 | Gene: | CG8067 / 36552 | FlyBaseID: | FBgn0033891 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001003645.1 | Gene: | carm1 / 445251 | ZFINID: | ZDB-GENE-040724-77 | Length: | 588 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 45/203 - (22%) |
---|---|---|---|
Similarity: | 72/203 - (35%) | Gaps: | 66/203 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 32 DRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRV-------------FDIKREFKAAADIGCS 83
Fly 84 RGYLS--------RHILAESVEQLTLTD------TSATMLEQAQGTPGLKMVKLVKDEEQLDFED 134
Fly 135 NSLDLVISS-LSLHWVND-LPGCFVRIKQSLKPDGVFIASMFGGDTLYELRSSLQLAELERKGGI 197
Fly 198 SPHISPFT 205 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8067 | NP_001260960.1 | BioC | 58..296 | CDD:273953 | 39/177 (22%) |
Methyltransf_11 | 79..170 | CDD:285453 | 28/106 (26%) | ||
carm1 | NP_001003645.1 | CARM1 | 8..112 | CDD:288395 | 2/4 (50%) |
PRMT5 | <146..409 | CDD:282971 | 37/163 (23%) | ||
AdoMet_MTases | 162..263 | CDD:100107 | 28/111 (25%) | ||
Transactivation domain. /evidence=ECO:0000250 | 473..588 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |