DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and fid

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_651453.3 Gene:fid / 43148 FlyBaseID:FBgn0259146 Length:1391 Species:Drosophila melanogaster


Alignment Length:123 Identity:29/123 - (23%)
Similarity:52/123 - (42%) Gaps:20/123 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DRNAKRLQKERAALSEDVGLYDYLKEEIG---FRLADRVFDIKREFKAAADIGCSRG-YLSR--- 89
            |.:.:....|||.:.:   :|::.:|..|   .|:|..:..:. ......|:||..| ||::   
  Fly   121 DASGRSAALERAYVHD---VYEHCEEPTGPVRPRMAHFLSGLD-PGSVVCDVGCGSGRYLTQCNP 181

  Fly    90 HILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLH 147
            .|....||:       ...|.:.....|.::.  :.|..:|.|.|:|.|.|:|...:|
  Fly   182 AICTIGVER-------CYRLSKVAHEKGGEVA--LCDNLELPFRDDSFDAVLSLAVVH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 23/97 (24%)
Methyltransf_11 79..170 CDD:285453 20/73 (27%)
fidNP_651453.3 Methyltransf_11 167..257 CDD:285453 20/73 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.