DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Art3

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650434.1 Gene:Art3 / 41837 FlyBaseID:FBgn0038306 Length:516 Species:Drosophila melanogaster


Alignment Length:411 Identity:83/411 - (20%)
Similarity:151/411 - (36%) Gaps:136/411 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TKLSTLKVKCELRALSSLTQTSQHIFDRNAKRLQKERAALSEDVGL------------------- 51
            |:.|.|:::..:...|.|.|.:    :.:.:|::.:..||.:.|..                   
  Fly   145 TQPSVLELQQRIAEQSQLLQQA----NEDMERMRNDYKALLQKVHADGEPKGSDQSVPRNNVCLD 205

  Fly    52 YDYLKEEIGF-----RLADRVFD-------IKREF----KAAADIGCSRGYLSRHILAE------ 94
            .:|.|....|     .|:|:|..       ::.|.    |...|:||..|.||  |.|.      
  Fly   206 NEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILS--IFASKAGAAR 268

  Fly    95 --SVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDE-EQLDFEDNSLDLVISSLSLHWV------- 149
              .::...:..|:..::.:.:    ::.|:|:|.. |..|..:...|::||    .|:       
  Fly   269 VVGIDNSDIVYTAMDIIRKNK----VENVELIKGRLEDTDLPETKYDIIIS----EWMGYFLLYE 325

  Fly   150 NDLPGCFVRIKQSLKPDGVFIASM-------FGGDTLY----ELRSSLQLAELE--RKGGISPHI 201
            :.|.......:..|.|:|:.:.|.       :|.||||    |..|::...::.  ||..|.   
  Fly   326 SMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIE--- 387

  Fly   202 SPFTQIRDIGSLLNR----AGFTMLTIDTDELVIGYPSMFELMWDLKGMAENNAAFNRPAHLSRE 262
            .|..|:.|...:|..    |.|.::|:|     :.||: |...:.||        ..:|..||  
  Fly   388 EPLMQVVDAEFMLTEPEQIANFDIMTVD-----MNYPN-FTHQFSLK--------VTKPGRLS-- 436

  Fly   263 TMLAASAIYQELYAKPNEKGIPATF------------QIIYFVGWKPGPNQPQPLERG---TGEV 312
               |....::.|:..|:    |..|            |.::|:      ..||.::.|   .|::
  Fly   437 ---AFVGYFETLFELPS----PVMFSTSPSATPTHWKQTVFFI------ENPQVVKEGDVICGKI 488

  Fly   313 S-------LKDLGSIIEKGGK 326
            :       ::.|...||..||
  Fly   489 TSRRHKEDVRGLSVDIEVFGK 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 62/298 (21%)
Methyltransf_11 79..170 CDD:285453 22/106 (21%)
Art3NP_650434.1 Methyltransf_18 243..346 CDD:289607 23/112 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.