DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Art1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_650017.1 Gene:Art1 / 41295 FlyBaseID:FBgn0037834 Length:376 Species:Drosophila melanogaster


Alignment Length:217 Identity:44/217 - (20%)
Similarity:84/217 - (38%) Gaps:48/217 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LKVKCELRALSSLTQTSQHIFDRNAKRLQKERA------ALSEDVGLYDY--------------L 55
            :.::..:.:.:.:|..|....:..||:|..|.:      |.::::...||              |
  Fly     6 IPMEAAVESATGITPNSNANSNNVAKKLPAEGSTGDNPNANADEMTSRDYYFDSYAHFGIHEEML 70

  Fly    56 KEE---IGFRLADRVFDIKREF--KAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGT 115
            |:|   :.:|.|  ::..|..|  |...|:||..|.||.........|:...|.| .::|.|:..
  Fly    71 KDEVRTVTYRNA--MYHNKHLFQGKTVLDVGCGTGILSMFAAKAGAAQVIAVDCS-NIIEFARQV 132

  Fly   116 -------PGLKMVKLVKDEEQLDFEDNSLDLVIS---SLSLHWVNDLPGCFVRIKQSLKPDGVFI 170
                   ..:.:||...:|.:|......:|::||   ...|.:.:.|........:.||.||:  
  Fly   133 VIDNNLQDVITVVKGKIEEIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGM-- 195

  Fly   171 ASMFGGDTLYELRSSLQLAELE 192
                    ::..|.:|.:..:|
  Fly   196 --------MFPDRGTLYITAIE 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 33/150 (22%)
Methyltransf_11 79..170 CDD:285453 24/100 (24%)
Art1NP_650017.1 AdoMet_MTases 94..194 CDD:100107 22/100 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.