DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and CG10903

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001262365.1 Gene:CG10903 / 40952 FlyBaseID:FBgn0037543 Length:276 Species:Drosophila melanogaster


Alignment Length:235 Identity:55/235 - (23%)
Similarity:88/235 - (37%) Gaps:34/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIGFRLADRVFDI-----KREFKAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPG 117
            ||...:|:|..::     ..|.:...||||..| ||..:|.:|.......|.|.:||:.|.....
  Fly    31 EIQVEMAERALELLALPDDDESRLILDIGCGSG-LSGSVLEDSEHMWIGIDISKSMLDIAVEREV 94

  Fly   118 LKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVR-IKQSLKPDGVFIASMFGGDTLYE 181
            ...|.|....|.:.|:..:.|..||..:|.|:.:....:.. .|:.||    |..::|...|   
  Fly    95 AGDVILGDMGEGMPFKPGTFDGAISISALQWLCNADKSYHNPHKRLLK----FFTTLFSCLT--- 152

  Fly   182 LRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPS-----MFELMW 241
             |::..:.:...:..        .||..:.|...:|||      ...||:.||:     .:.|:.
  Fly   153 -RTARAVFQFYPENS--------DQIEMVTSQAMKAGF------YGGLVVDYPNSAKAKKYYLVL 202

  Fly   242 DLKGMAENNAAFNRPAHLSRETMLAASAIYQELYAKPNEK 281
            ...|.||...|...|....|...:......:|...|..:|
  Fly   203 MTGGSAELPQALGSPEEERRVNYIKKRDACREARGKAPKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 55/235 (23%)
Methyltransf_11 79..170 CDD:285453 26/91 (29%)
CG10903NP_001262365.1 Methyltransf_11 56..142 CDD:285453 24/86 (28%)
WBS_methylT 202..272 CDD:289366 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.