DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and gstcd

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001019633.1 Gene:gstcd / 402871 ZFINID:ZDB-GENE-050320-41 Length:614 Species:Danio rerio


Alignment Length:189 Identity:40/189 - (21%)
Similarity:68/189 - (35%) Gaps:58/189 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDF--EDNSLDLVISSLSLHWVNDLPGCFVRI 159
            :|..|.:..|.:|.|||  ||..:|         ||  ....:.:|::.:       ||.|.|.:
Zfish   404 KQQQLDNLLAMVLNQAQ--PGHTVV---------DFCSGGGHVGIVLAYM-------LPKCQVIL 450

  Fly   160 KQSLKPDGVFIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTI 224
            .::.:            ::|...|.......|...|.|..::..||...:||..|:..|     :
Zfish   451 VENKE------------ESLIRARERSAQLTLTNIGFIQTNLDYFTGNFNIGVALHACG-----V 498

  Fly   225 DTDELV-------IGY---PSMFELMWDLKGMAENNAAFNRPAHLSRETMLAASAIYQE 273
            .||.::       .|:   |..:       |..:|...||.|    :....|.:..|:|
Zfish   499 ATDMVLDRCLQARAGFVISPCCY-------GFIQNTLKFNFP----KSARFAETLSYKE 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 40/189 (21%)
Methyltransf_11 79..170 CDD:285453 17/74 (23%)
gstcdNP_001019633.1 AdoMet_MTases 403..521 CDD:327401 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.