DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Art7

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611753.4 Gene:Art7 / 37664 FlyBaseID:FBgn0034817 Length:690 Species:Drosophila melanogaster


Alignment Length:352 Identity:68/352 - (19%)
Similarity:121/352 - (34%) Gaps:128/352 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HIFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADIGCSRGYLSRHILA 93
            |.::||    ||..|||.:.:.         |.|.|.|...:       .|||...|.||...||
  Fly    40 HDWERN----QKYFAALRKTIA---------GMREAGREVHV-------LDIGTGTGILSMMALA 84

  Fly    94 ESVEQLTLTDT---SATMLEQAQGTPG----LKMVKLVKDEEQL--DFEDNSLDLVISSLSLHWV 149
            ...:.:|..:.   .|...|:.....|    :::::....|.|:  |....:..||...|....:
  Fly    85 AGADSVTACEAFLPMANCAEKILAANGAGDKVRLIRKRSTEIQVGEDMPRKANLLVAELLDTELI 149

  Fly   150 ND--------------------LPG---CFVRIKQ--------SLKPDGVFIASMFGGDTLY--- 180
            .:                    :|.   |:.::.|        |||.    ||::.|...|:   
  Fly   150 GEGAIGIYNHAHAELLTEDALCIPARARCYAQVAQSPLAAQWNSLKT----IANLDGEPLLHPPE 210

  Fly   181 ELRS--------SLQLAELERKGGISPHISPFTQIRDIGSL-------LNRAGFTMLTIDTDELV 230
            :|:|        .:||::|.     |....|.|...:|...       ..:....:|.:.:.:  
  Fly   211 QLKSCQGEAALHDVQLSQLP-----SSAFRPLTDPVEIFQFDFQRKQEREKQRSQLLKLQSKQ-- 268

  Fly   231 IGYPSMFELM---WDLKGMAENNAAFNRPAHLSRETMLAASAIY-----QELYA-KPNEKGIPAT 286
               |...||:   ||::  .:::.          |.:|:.:..:     :||.| |..:..:|..
  Fly   269 ---PGAAELVFYWWDIQ--LDDDG----------EILLSCAPYWAHPQLKELAAEKAKDHPLPNV 318

  Fly   287 -------FQIIYFVGWKPGPNQPQPLE 306
                   .|.||::        |:||:
  Fly   319 VPWRDHWMQAIYYI--------PKPLQ 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 57/311 (18%)
Methyltransf_11 79..170 CDD:285453 24/130 (18%)
Art7NP_611753.4 AdoMet_MTases 36..>186 CDD:302624 33/165 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.