DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and CG17807

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_611690.2 Gene:CG17807 / 37585 FlyBaseID:FBgn0034748 Length:615 Species:Drosophila melanogaster


Alignment Length:215 Identity:48/215 - (22%)
Similarity:80/215 - (37%) Gaps:65/215 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KLTKLSTLKVK-----CELRALSSLTQTSQHIFDRNAKRLQKERAAL-SEDVGLYDYLKEEIGFR 62
            |.|.|:..:::     |...||....||         |..|:..|:| ::.:.|......|:..:
  Fly   315 KRTSLTFRRLRKGPCDCSYPALCDTQQT---------KVPQELHASLAAQAITLEQQNVHEVYDK 370

  Fly    63 LADRVFDIKR-------EF-------KAAADIGCSRG-YLSRHILAESVEQLTLTDTSATMLEQA 112
            :||...:.:.       ||       ....||||..| |||.:.|..||.           .::|
  Fly   371 IADHFSETRHTPWPQVSEFLDSFEPQSVVLDIGCGNGKYLSCNPLLLSVG-----------CDRA 424

  Fly   113 QGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGGD 177
            ||     ::.:.:.:.|..|..:.|.:.:.|.|      :.||            :.||.:....
  Fly   425 QG-----LLAVGRRKGQNVFRCDCLVVPVRSSS------IDGC------------ISIAVIHHLA 466

  Fly   178 TLYELRSSLQ-LAELERKGG 196
            |.....::|| :|.:.|.||
  Fly   467 TKERRLAALQEMARVLRPGG 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 35/155 (23%)
Methyltransf_11 79..170 CDD:285453 21/91 (23%)
CG17807NP_611690.2 RRM_ALKBH8 40..119 CDD:240877
2OG-FeII_Oxy 136..322 CDD:304390 3/6 (50%)
Methyltransf_11 400..490 CDD:285453 30/121 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.