DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Bud23

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001129215.1 Gene:Bud23 / 368084 RGDID:1589742 Length:281 Species:Rattus norvegicus


Alignment Length:262 Identity:53/262 - (20%)
Similarity:83/262 - (31%) Gaps:115/262 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSSLTQTSQH------IFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAA 78
            ::|.::..:|      .:|:|..|               .|::.       .|:.||:.:....|
  Rat     1 MASRSRRPEHSGPPELFYDQNEAR---------------KYVRN-------SRMIDIQTKMTERA 43

  Fly    79 ---------------DIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA---------------Q 113
                           ||||..| ||...::|........|.|..||:.|               |
  Rat    44 LELLCLPEGQPSYLLDIGCGSG-LSGDYISEEGHYWVGIDISPAMLDAALDRDTEGDLLLGDMGQ 107

  Fly   114 GTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWV------NDLPG----CFVRIKQSLKPDGV 168
            |.|               |...|.|..||..::.|:      :|:|.    ||.        ..:
  Rat   108 GVP---------------FRPGSFDGCISISAVQWLCNANKKSDIPARRLYCFF--------SSL 149

  Fly   169 FIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGY 233
            :.|.:.|.      |:.|||         .|..|  .|:..|.:...||||      |..:|:.:
  Rat   150 YSALVRGA------RAVLQL---------YPENS--EQLELITTQATRAGF------TGGVVVDF 191

  Fly   234 PS 235
            |:
  Rat   192 PN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 47/218 (22%)
Methyltransf_11 79..170 CDD:285453 26/115 (23%)
Bud23NP_001129215.1 UbiG 18..>91 CDD:225137 20/95 (21%)
Methyltransf_11 58..>128 CDD:400514 21/85 (25%)
WBS_methylT 204..279 CDD:403702
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.