Sequence 1: | NP_001260960.1 | Gene: | CG8067 / 36552 | FlyBaseID: | FBgn0033891 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001129215.1 | Gene: | Bud23 / 368084 | RGDID: | 1589742 | Length: | 281 | Species: | Rattus norvegicus |
Alignment Length: | 262 | Identity: | 53/262 - (20%) |
---|---|---|---|
Similarity: | 83/262 - (31%) | Gaps: | 115/262 - (43%) |
- Green bases have known domain annotations that are detailed below.
Fly 20 LSSLTQTSQH------IFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAA 78
Fly 79 ---------------DIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA---------------Q 113
Fly 114 GTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWV------NDLPG----CFVRIKQSLKPDGV 168
Fly 169 FIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGY 233
Fly 234 PS 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8067 | NP_001260960.1 | BioC | 58..296 | CDD:273953 | 47/218 (22%) |
Methyltransf_11 | 79..170 | CDD:285453 | 26/115 (23%) | ||
Bud23 | NP_001129215.1 | UbiG | 18..>91 | CDD:225137 | 20/95 (21%) |
Methyltransf_11 | 58..>128 | CDD:400514 | 21/85 (25%) | ||
WBS_methylT | 204..279 | CDD:403702 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |