DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Carm1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001025212.1 Gene:Carm1 / 363026 RGDID:1305879 Length:608 Species:Rattus norvegicus


Alignment Length:206 Identity:45/206 - (21%)
Similarity:72/206 - (34%) Gaps:66/206 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 HIFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRV-------------FDIKREFKAAADI 80
            |..:|:....:.|.::..:....|.||.::... :.|.|             .|.|.  |...|:
  Rat   131 HTLERSVFSERTEESSAVQYFQFYGYLSQQQNM-MQDYVRTGTYQRAILQNHTDFKD--KIVLDV 192

  Fly    81 GCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLD--------FEDNSL 137
            ||..|.||.........::...:.| ||.:.|:        .|||.....|        .|:.||
  Rat   193 GCGSGILSFFAAQAGARKIYAVEAS-TMAQHAE--------VLVKSNNLTDRIVVIPGKVEEVSL 248

  Fly   138 ----DLVISS-LSLHWVND-LPGCFVRIKQSLKPDGVFIASMFG--GDTLYELRSSLQLAELERK 194
                |::||. :.....|: :...::..|:.|||.|    :||.  ||.                
  Rat   249 PEQVDIIISEPMGYMLFNERMLESYLHAKKYLKPSG----NMFPTIGDV---------------- 293

  Fly   195 GGISPHISPFT 205
                 |::|||
  Rat   294 -----HLAPFT 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 39/177 (22%)
Methyltransf_11 79..170 CDD:285453 26/104 (25%)
Carm1NP_001025212.1 CARM1 35..139 CDD:402914 2/7 (29%)
AdoMet_MTases 189..284 CDD:100107 25/103 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.