DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Art8

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_609478.1 Gene:Art8 / 34528 FlyBaseID:FBgn0032329 Length:341 Species:Drosophila melanogaster


Alignment Length:82 Identity:19/82 - (23%)
Similarity:35/82 - (42%) Gaps:11/82 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KAAADIGCSRGYLSRHI------LAESVEQLTL-TDTSATMLEQAQGTPGLKMVKLVKDEEQLDF 132
            |...|:|...|.||...      |..:||...: |..:..::|....|..:|:::...:|..|..
  Fly    42 KIVMDVGAGTGILSAFCAKAGARLVYAVEASNVATKVALDLIEDNGLTNVVKVIQSRVEEFVLPA 106

  Fly   133 EDNSLDLVISSLSLHWV 149
            |...:|:::|    .|:
  Fly   107 EAEKVDIIVS----EWM 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 19/82 (23%)
Methyltransf_11 79..170 CDD:285453 18/78 (23%)
Art8NP_609478.1 SmtA 1..244 CDD:223574 19/82 (23%)
Methyltransf_18 40..147 CDD:289607 19/82 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.