DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Art2

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001285600.1 Gene:Art2 / 33631 FlyBaseID:FBgn0031592 Length:355 Species:Drosophila melanogaster


Alignment Length:335 Identity:65/335 - (19%)
Similarity:120/335 - (35%) Gaps:121/335 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 TQTSQHIFDRNAKRLQKERAALSEDVGLYDY-LKEEIGFRLADRVFDIKREF---KAAADIGCSR 84
            |..:|.|.||  :|.::....|...:.:::: ||:.:..: |.|......||   |...|:||..
  Fly    17 TDANQIIKDR--RRQEEHYFKLYGRIEIHEWLLKDSVRIK-AYREAIQHNEFFRHKTVLDVGCGM 78

  Fly    85 GYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWV 149
            |.||. ..|::..:..|...:||:.|.||        ::|:|.|                     
  Fly    79 GVLSM-FAAKAGSKRVLAVEAATISEFAQ--------QVVQDNE--------------------- 113

  Fly   150 NDLPGCFVRIKQSLK--------PDGV---------FIAS-MFGGDTLYELRSSLQLAELERKGG 196
                  |.|:.|.::        |||:         ::.| :|.|:.|..|     |...::...
  Fly   114 ------FGRVIQVIQGKVEDIELPDGIKKVDIIVCDWMGSCLFSGNMLESL-----LFARDKWLS 167

  Fly   197 ISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPSMFELMW-DLKGM--------AENNAA 252
            .:.||.|.|....:.::..|        |.|   :|:       | |:.|.        .|:.|.
  Fly   168 ATGHIYPDTAQLYLAAIKGR--------DQD---LGF-------WHDVHGFDLSAIRRRCESKAV 214

  Fly   253 FNRPAHLSRETMLAASAIYQ--ELYAKPNEK------------------GIPATFQIIYF----- 292
            ..   |::.:.|::...:.:  :||.:|.:.                  |:.|.|.:.:.     
  Fly   215 VE---HVTGDQMMSRVCLVKSLDLYTEPRQSAKSRSLFELKVSRNGWVHGLVAYFDVGFSKSTQR 276

  Fly   293 VGWKPGPNQP 302
            :.:...|:.|
  Fly   277 ISFSTSPSAP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 54/292 (18%)
Methyltransf_11 79..170 CDD:285453 22/107 (21%)
Art2NP_001285600.1 AdoMet_MTases 70..>150 CDD:100107 23/115 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.