DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and PRMT1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001527.3 Gene:PRMT1 / 3276 HGNCID:5187 Length:371 Species:Homo sapiens


Alignment Length:203 Identity:38/203 - (18%)
Similarity:75/203 - (36%) Gaps:53/203 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 SLTQTSQHIFDRNAKRLQKERAALSEDVGLYDY--------------LKEEI-GFRLADRVFDIK 71
            ||....:.:....|:..:|..|   ||:...||              ||:|: .....:.:|..:
Human    23 SLQPPLEEVSCGQAESSEKPNA---EDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNR 84

  Fly    72 REF--KAAADIGCSRGYL--------SRHIL---AESVEQLTLTDTSATMLEQAQGTPGLKMVKL 123
            ..|  |...|:|...|.|        :|.::   ..|:....:....|..|:.        :|.:
Human    85 HLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDH--------VVTI 141

  Fly   124 VKDE-EQLDFEDNSLDLVIS---SLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLYELRS 184
            :|.: |:::.....:|::||   ...|.:.:.|........:.|.|||:          ::..|:
Human   142 IKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYARDKWLAPDGL----------IFPDRA 196

  Fly   185 SLQLAELE 192
            :|.:..:|
Human   197 TLYVTAIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 27/153 (18%)
Methyltransf_11 79..170 CDD:285453 20/105 (19%)
PRMT1NP_001527.3 AdoMet_MTases 92..192 CDD:100107 20/117 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.