DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Trmt9b

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001100784.1 Gene:Trmt9b / 306504 RGDID:1304810 Length:446 Species:Rattus norvegicus


Alignment Length:70 Identity:20/70 - (28%)
Similarity:31/70 - (44%) Gaps:6/70 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 ADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVIS 142
            |||||..|   :::...|.......|....::|.|:.. |.::  :|.|...|.|.|...|.:||
  Rat    49 ADIGCGTG---KYLKVNSQVHTLGCDYCGPLVEIARNR-GCEV--MVCDNLNLPFRDQGFDAIIS 107

  Fly   143 SLSLH 147
            ...:|
  Rat   108 IGVIH 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 20/70 (29%)
Methyltransf_11 79..170 CDD:285453 19/69 (28%)
Trmt9bNP_001100784.1 Methyltransf_11 50..139 CDD:285453 19/69 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.