DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and K12D9.1

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_503823.2 Gene:K12D9.1 / 187323 WormBaseID:WBGene00019675 Length:354 Species:Caenorhabditis elegans


Alignment Length:301 Identity:63/301 - (20%)
Similarity:101/301 - (33%) Gaps:108/301 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 ELRALSSLTQTSQHIFDRNAKRLQKERAALSEDVGLYDYLKEEIGFRLADRVFDIKREFKAAADI 80
            :::|:.:.|...||:..                 ||.......|..:|.|..|.:       .|:
 Worm   132 DMQAMFTKTVYEQHMIS-----------------GLIPAFGNGIKEKLEDGGFRV-------LDV 172

  Fly    81 GCSRGYLSRHILAE--SVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQLDFEDNSLDLVISS 143
            ||..|:.| .:|||  |..|....|    :.|:|     :|..||.|..:..||:  :|:.|:..
 Worm   173 GCGEGFHS-CLLAENYSKSQFVGLD----ICEKA-----IKSAKLNKKSDGSDFQ--NLEFVVGD 225

  Fly   144 LSLHWVNDLPGCF-------------------VRIKQSLKPDG-VFIASMFGGDTLYELRSSLQL 188
             ::....|..|||                   :.:.:.|||.| |.:....|...:::.|.:...
 Worm   226 -AMIMPEDWTGCFDLVAFFGSLHDLLRPDLSLLEVHRVLKPGGMVVLTESDGTSNVFQDREAFGK 289

  Fly   189 AELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDTDELVIGYPSMFELMWDLKGMAENNAAF 253
            ....:.||...|..|      :||..:.|             :||.|    ||..|         
 Worm   290 MSALQYGGSMLHCLP------VGSNSSDA-------------MGYGS----MWGRK--------- 322

  Fly   254 NRPAHLSRETMLAASAIYQELYAKPNEKGIPATFQIIYFVG 294
                   |.|.|.....::::...|          ||:|.|
 Worm   323 -------RATELMTKCGFKDIEITP----------IIHFPG 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 57/259 (22%)
Methyltransf_11 79..170 CDD:285453 30/112 (27%)
K12D9.1NP_503823.2 Methyltransf_31 163..>282 CDD:316372 33/138 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.