DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and R08F11.4

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_504052.1 Gene:R08F11.4 / 178797 WormBaseID:WBGene00019968 Length:354 Species:Caenorhabditis elegans


Alignment Length:191 Identity:48/191 - (25%)
Similarity:74/191 - (38%) Gaps:46/191 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 IKREFKAAA----DIGCSRGYLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVKDEEQL 130
            ||.:.:|..    |:||..|:.| .:|||...:........|  |:|     :|..:|.|..:..
 Worm   158 IKEKLEAGGIRVLDVGCGGGFHS-GLLAEHYPKSQFVGLDIT--EKA-----IKAARLKKKSDGT 214

  Fly   131 DFED----------------NSLDLVISSLSLH--WVNDLPGCFVRIKQSLKPDG-VFIASMFGG 176
            |||:                :|.||||...|.|  ...||  |.:.:.:.:|||| |.:..:.|.
 Worm   215 DFENLEFVVADAAIMPSSWTDSFDLVILFGSCHDQMRPDL--CLLEVHRVVKPDGLVAVTDVDGS 277

  Fly   177 DTLYELRSSLQLAELERKGGISPHISPFTQIRD----IGS---------LLNRAGFTMLTI 224
            ..::..|.:.......:.||...|..|....|.    .||         ::|:.||..:.|
 Worm   278 SNVFTDRETYGKMAAMKYGGSMLHCLPVGSNRPDALCCGSMWGRKRAVEIMNKCGFDNIDI 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 48/191 (25%)
Methyltransf_11 79..170 CDD:285453 32/109 (29%)
R08F11.4NP_504052.1 Methyltransf_31 165..>281 CDD:316372 33/125 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.