Sequence 1: | NP_001260960.1 | Gene: | CG8067 / 36552 | FlyBaseID: | FBgn0033891 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501633.1 | Gene: | F49C12.10 / 177754 | WormBaseID: | WBGene00009879 | Length: | 275 | Species: | Caenorhabditis elegans |
Alignment Length: | 206 | Identity: | 40/206 - (19%) |
---|---|---|---|
Similarity: | 65/206 - (31%) | Gaps: | 66/206 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 47 EDVG-LYDYLKEEIGFRLADRVFDIKREFK-----AAADIGCSRGYLSRHILAESVEQLTLTDTS 105
Fly 106 ATMLEQAQG------------TPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVR 158
Fly 159 IKQSLKPDGVFIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLT 223
Fly 224 ID--TDELVIG 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8067 | NP_001260960.1 | BioC | 58..296 | CDD:273953 | 35/194 (18%) |
Methyltransf_11 | 79..170 | CDD:285453 | 20/102 (20%) | ||
F49C12.10 | NP_501633.1 | Methyltransf_11 | 97..182 | CDD:369777 | 20/103 (19%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |