DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and BUD23

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:XP_006715910.1 Gene:BUD23 / 114049 HGNCID:16405 Length:304 Species:Homo sapiens


Alignment Length:296 Identity:68/296 - (22%)
Similarity:103/296 - (34%) Gaps:104/296 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 EIGFRLADRVFDI--KREFKAA--ADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA------ 112
            :|..|:|.|..::  ..|.|..  .||||..| ||...|::........|.|..||::|      
Human    57 DIQTRMAGRALELLYLPENKPCYLLDIGCGTG-LSGSYLSDEGHYWVGLDISPAMLDEAVDREIE 120

  Fly   113 ---------QGTPGLKMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDG- 167
                     ||.|               |:..:.|..||..::.|:     |... |:|..|.. 
Human   121 GDLLLGDMGQGIP---------------FKPGTFDGCISISAVQWL-----CNAN-KKSENPAKR 164

  Fly   168 --VFIASMFG----GDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSLLNRAGFTMLTIDT 226
              .|.||:|.    |.     |:.|||         .|..|  .|:..|.:...:|||      :
Human   165 LYCFFASLFSVLVRGS-----RAVLQL---------YPENS--EQLELITTQATKAGF------S 207

  Fly   227 DELVIGYPS-----MFEL-------MWDLKGMAEN------------NAAFNRPAHLSRETMLAA 267
            ..:|:.||:     .|.|       .:..:|::||            |..|  |..:||..|:..
Human   208 GGMVVDYPNSAKAKKFYLCLFSGPSTFIPEGLSENQDEVEPRESVFTNERF--PLRMSRRGMVRK 270

  Fly   268 SAIY----QELYAKPNEKGIPATFQIIYFVGWKPGP 299
            |..:    :|.:.:...:..|.|    .:.|.|..|
Human   271 SRAWVLEKKERHRRQGREVRPDT----QYTGRKRKP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 66/291 (23%)
Methyltransf_11 79..170 CDD:285453 25/108 (23%)
BUD23XP_006715910.1 AdoMet_MTases 38..>117 CDD:302624 19/60 (32%)
Methyltransf_11 81..184 CDD:285453 31/129 (24%)
WBS_methylT 227..302 CDD:289366 15/80 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.