DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and Prmt9

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001074709.1 Gene:Prmt9 / 102182 MGIID:2142651 Length:846 Species:Mus musculus


Alignment Length:325 Identity:62/325 - (19%)
Similarity:104/325 - (32%) Gaps:125/325 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 KAAADIGCSRGYLSRHILAESVEQLTLTDTSATMLEQA-------QGTPGLKMVKLVKDEEQLDF 132
            :...|||...|.||........:.:...:.|.||.|.|       :...|:|::.:    :.||.
Mouse   179 RTVLDIGTGTGILSMFAKKAGAQSVYACELSKTMYELACDVVAANKMENGIKLLHM----KSLDI 239

  Fly   133 E-------------DNSLDL------VISSLSLHWVNDLPGCFVRIKQSLK-------------P 165
            |             ..::|.      ::.||...|.:.|      ::...|             |
Mouse   240 EIPKHIPERVSLVVTETVDAGVFGEGIVESLIHAWEHLL------LQPKTKEENGNCGKYGKVIP 298

  Fly   166 DGVFIASMFGGDTLYELRSSLQLAELERKGGISPHISPFTQIRDIGSL-------LNRAGFTMLT 223
            .|..|..|           :::.||:.|...:.        .:||..:       .....:|  :
Mouse   299 AGAVIFGM-----------AVECAEIRRHHRVG--------AKDIAGIHLPTNVKFQSPAYT--S 342

  Fly   224 IDTDELVIGYPS---------------MFELM-------WDLKGMAENNA-AFNRPAHLSRETML 265
            :||:|.|..|.:               .|::|       .:||.:|.... :.|.||  .:|.:|
Mouse   343 VDTEETVEPYTTEKMSGIPGGYLPLTECFQIMKVDFNNLQELKSLATKKPHSLNVPA--IKEGVL 405

  Fly   266 AASAIY--------QELYAKPNEKGIPATFQIIYFVGWKPGPNQP------QPLERGTGEVSLKD 316
            .|..::        ..|...|:|:  ....|.:|       |.|.      ||.:|.|.|.|..|
Mouse   406 DAIMVWFVLQLDDEYSLSTSPSEE--TCWEQAVY-------PVQALEDYCIQPGDRVTMEASCHD 461

  Fly   317  316
            Mouse   462  461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 53/297 (18%)
Methyltransf_11 79..170 CDD:285453 24/129 (19%)
Prmt9NP_001074709.1 TPR 1 25..58
TPR 2 67..100
TPR_11 68..132 CDD:290150
TPR repeat 68..95 CDD:276809
TPR repeat 100..130 CDD:276809
TPR 3 101..134
AdoMet_MTases 148..>303 CDD:302624 24/133 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0500
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.