DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8067 and pmt

DIOPT Version :9

Sequence 1:NP_001260960.1 Gene:CG8067 / 36552 FlyBaseID:FBgn0033891 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_001096276.2 Gene:pmt / 100124841 XenbaseID:XB-GENE-5904605 Length:494 Species:Xenopus tropicalis


Alignment Length:159 Identity:41/159 - (25%)
Similarity:71/159 - (44%) Gaps:26/159 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 REFKAAADIGCSRG----YLSRHILAESVEQLTLTDTSATMLEQAQGTPGLKMVKLVK----DEE 128
            |..:...|:||..|    |:::   ...||.|.: |.|:.|:|.|.....::.:.||:    |..
 Frog   278 RPGQRVVDVGCGIGGGDFYMAK---TYGVEVLGM-DLSSNMVEIAMERAIIEKIPLVQFEIGDAT 338

  Fly   129 QLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDG-VFIASMFGGDTLYELRSSLQLAELE 192
            :..|.:.|.|:|.|..::..:||....|.|....|||.| :.|.....|:..:   |.:....::
 Frog   339 KRSFSEASFDVVYSRDTILHINDKEALFRRFYTWLKPGGKLLITDYCCGERPW---SPVFQEYVK 400

  Fly   193 RKGGI--SPHISPFTQIRDIGSLLNRAGF 219
            ::|.|  :|        ::.|..|.:|||
 Frog   401 QRGYILYTP--------QEYGQFLEKAGF 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8067NP_001260960.1 BioC 58..296 CDD:273953 41/159 (26%)
Methyltransf_11 79..170 CDD:285453 29/99 (29%)
pmtNP_001096276.2 PLN02336 14..488 CDD:177970 41/159 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.