Sequence 1: | NP_001260960.1 | Gene: | CG8067 / 36552 | FlyBaseID: | FBgn0033891 | Length: | 333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001122287.1 | Gene: | zgc:194242 / 100005854 | ZFINID: | ZDB-GENE-081022-84 | Length: | 210 | Species: | Danio rerio |
Alignment Length: | 196 | Identity: | 34/196 - (17%) |
---|---|---|---|
Similarity: | 65/196 - (33%) | Gaps: | 71/196 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 91 ILAESVEQLTLTDTSATMLEQAQGTPGL------------------------------------- 118
Fly 119 ---KMVKLVKDEEQLDFEDNSLDLVISSLSLHWVNDLPGCFVRIKQSLKPDGVFIASMFGGDTLY 180
Fly 181 ELRSSLQLAELER-------KGGI-SPHISPFTQIRDIGSLLNRAGFTMLTI-DTDELVIGYPSM 236
Fly 237 F 237 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8067 | NP_001260960.1 | BioC | 58..296 | CDD:273953 | 34/196 (17%) |
Methyltransf_11 | 79..170 | CDD:285453 | 20/118 (17%) | ||
zgc:194242 | NP_001122287.1 | Methyltransf_11 | 55..150 | CDD:285453 | 14/95 (15%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0500 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |