powered by:
Protein Alignment CG8067 and antkmt
DIOPT Version :9
Sequence 1: | NP_001260960.1 |
Gene: | CG8067 / 36552 |
FlyBaseID: | FBgn0033891 |
Length: | 333 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001002083.1 |
Gene: | antkmt / 100000855 |
ZFINID: | ZDB-GENE-040625-59 |
Length: | 213 |
Species: | Danio rerio |
Alignment Length: | 62 |
Identity: | 16/62 - (25%) |
Similarity: | 28/62 - (45%) |
Gaps: | 4/62 - (6%) |
- Green bases have known domain annotations that are detailed below.
Fly 259 LSRETMLAASAIYQELYAKPNEKGIPATFQIIYFVGWKPGPNQPQPLERG-TGEVSLKDLGS 319
|:..|.|...|::..: ..|..:.:|...|:.|....|...:....|.:| :|.:: ||||
Zfish 26 LTAATGLTVYAVWAGI-LMPGFRRVPLKLQVPYIPASKAQVSNVMTLMKGRSGGIA--DLGS 84
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG8067 | NP_001260960.1 |
BioC |
58..296 |
CDD:273953 |
8/36 (22%) |
Methyltransf_11 |
79..170 |
CDD:285453 |
|
antkmt | NP_001002083.1 |
None |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0500 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.