DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6701 and 4933416I08Rik

DIOPT Version :9

Sequence 1:NP_001188923.1 Gene:CG6701 / 36550 FlyBaseID:FBgn0033889 Length:1333 Species:Drosophila melanogaster
Sequence 2:NP_081976.1 Gene:4933416I08Rik / 71159 MGIID:1918409 Length:280 Species:Mus musculus


Alignment Length:290 Identity:70/290 - (24%)
Similarity:111/290 - (38%) Gaps:89/290 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   419 LRTLL--------QVEDIERLQHYLSLKQSEMELHQFGRELSVKMQMGT-TSMS-----VEDI-- 467
            ||.:|        .|..:||.|           :||.| ||:.|:.||| ||..     :||.  
Mouse    25 LRLILGVVYYFQWDVPSVERGQ-----------IHQEG-ELNTKIVMGTVTSFGNDYGWIEDCIF 77

  Fly   468 -----------LSPGDDVLIINEKGNPKSAVRKMLENNNNVLELALKDFDSILRWARNVDGMVGS 521
                       |..||.||...|: :|.|...|..|...:..|...||.||.:   :::...|..
Mouse    78 FSSDAIIGSIPLRTGDKVLAFVEE-DPLSHELKATEVCVSSEEGVSKDADSKV---KDLSVCVSQ 138

  Fly   522 LDKQ-----PRVYF------ARILGVSTQR-----VNITCERQLPDNTTYTLIFRPLRAVMRYQY 570
            :.|.     ...||      ..|||.:.:.     :..:.|:..|..|.:        :|...|.
Mouse   139 VKKNFIYIGDEYYFYLDSISKAILGFTPREGDWLDIEYSVEQGSPKITVH--------SVKATQR 195

  Fly   571 RALQQLSFT---------RHSDVQRILFPGEIPNTPLA-SGVL-QLNNKLISTNPEQMQAVRQIA 624
            |.|:::..|         .|:    |.|..:..|.||. :.:| .:.|.:|..:.:|....|.|:
Mouse   196 RQLEEVCVTSIHKRKGMLNHT----IFFTLDSLNLPLGYTPILGHMVNVVIIQSTQQNYKWRAIS 256

  Fly   625 LSPRLKAPYIV-FGPPGTGKTSTIVEAIYQ 653
            ::|  .:|.:| .||    :.|:.:..:||
Mouse   257 MTP--ISPTVVGIGP----RNSSSLLFLYQ 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6701NP_001188923.1 TIGR00376 424..1037 CDD:273041 67/277 (24%)
AAA_19 618..687 CDD:289986 10/37 (27%)
AAA_12 812..1019 CDD:289832
4933416I08RikNP_081976.1 S1-like 60..>103 CDD:291136 12/43 (28%)
S1-like 203..254 CDD:291136 11/54 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167831394
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.