DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6701 and helz2c

DIOPT Version :9

Sequence 1:NP_001188923.1 Gene:CG6701 / 36550 FlyBaseID:FBgn0033889 Length:1333 Species:Drosophila melanogaster
Sequence 2:NP_001018332.1 Gene:helz2c / 552926 ZFINID:ZDB-GENE-050508-3 Length:231 Species:Danio rerio


Alignment Length:179 Identity:40/179 - (22%)
Similarity:67/179 - (37%) Gaps:53/179 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   939 IGIISPYKNQYQRIQEQLNMRNWSQIDCGSVELFQGKEKHVIIVSFVRSFT-------------- 989
            |.|::||..|...|:..|..:|...:...:|...||.|...:|||.|||.:              
Zfish    75 IAILTPYNAQVSEIKMTLEKKNVRNVTVCTVMKSQGSEWPYVIVSTVRSCSTSDIQAYRVRPHKA 139

  Fly   990 ---PKLGFLNNERRLNVLLSRPISLLILIGNPRTLSQNSDFQHIIEMCRNRKTLVGEQYLNEDFI 1051
               .:|||:.:..::||.::|....|.::|       |||   ::..|.....|: :.|..:..:
Zfish   140 WLGKRLGFVTDANQVNVAITRAQDGLCILG-------NSD---LLRCCELWDRLL-DHYYRKSCV 193

  Fly  1052 TNKKTGANNVNKGGAAGDQPASGLRQPLKRKNHAKNPVQDAKIFYSKNE 1100
            .|                 |||.:|        .|....:....|:.|:
Zfish   194 VN-----------------PASDIR--------VKAKASEGLAIYTGNQ 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6701NP_001188923.1 TIGR00376 424..1037 CDD:273041 30/114 (26%)
AAA_19 618..687 CDD:289986
AAA_12 812..1019 CDD:289832 26/96 (27%)
helz2cNP_001018332.1 UvrD_C_2 <58..172 CDD:304668 27/103 (26%)
DNA2 <60..194 CDD:224037 32/129 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.