DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6701 and CT55

DIOPT Version :9

Sequence 1:NP_001188923.1 Gene:CG6701 / 36550 FlyBaseID:FBgn0033889 Length:1333 Species:Drosophila melanogaster
Sequence 2:NP_001026875.1 Gene:CT55 / 54967 HGNCID:26047 Length:264 Species:Homo sapiens


Alignment Length:195 Identity:40/195 - (20%)
Similarity:73/195 - (37%) Gaps:55/195 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   931 GEKLLQTDIGIISPYKNQYQRIQEQLNMRNWSQIDCGSVELFQGKEKHVIIVSFVRSFTPKLGFL 995
            |:..|.|..|:::.:...|..|.|.:...  |.:..|:|.|..|::.:|:    |....|..|. 
Human    32 GDTQLTTVQGVVTSFCGDYGMIDESIYFS--SDVVTGNVPLKVGQKVNVV----VEEDKPHYGL- 89

  Fly   996 NNERRLNV-LLSRPI--------SLLILIGNPRTLSQNSDFQHIIEMCRNRKTLVGEQYLNEDFI 1051
               |.:.| ::.|.:        ...:|||  ...|.|.|..:|     :.........::|||:
Human    90 ---RAIKVDVVPRHLYGAGPSDSGTRVLIG--CVTSINEDNIYI-----SNSIYFSIAIVSEDFV 144

  Fly  1052 TNK----------KTGANNVNKGGAAGDQPASGLRQPLK---------RKNHAKNPVQDAKIFYS 1097
            ..|          :.|.:|:.         |:.:: |::         ...|.:|.|.|..||::
Human   145 PYKGDLLEVEYSTEPGISNIK---------ATSVK-PIRCIHTEEVCITSVHGRNGVIDYTIFFT 199

  Fly  1098  1097
            Human   200  199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6701NP_001188923.1 TIGR00376 424..1037 CDD:273041 26/114 (23%)
AAA_19 618..687 CDD:289986
AAA_12 812..1019 CDD:289832 22/96 (23%)
CT55NP_001026875.1 S1-like 41..>78 CDD:316926 9/38 (24%)
S1-like 182..233 CDD:316926 6/18 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..264
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165141439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1112
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.