Sequence 1: | NP_001188923.1 | Gene: | CG6701 / 36550 | FlyBaseID: | FBgn0033889 | Length: | 1333 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001026875.1 | Gene: | CT55 / 54967 | HGNCID: | 26047 | Length: | 264 | Species: | Homo sapiens |
Alignment Length: | 195 | Identity: | 40/195 - (20%) |
---|---|---|---|
Similarity: | 73/195 - (37%) | Gaps: | 55/195 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 931 GEKLLQTDIGIISPYKNQYQRIQEQLNMRNWSQIDCGSVELFQGKEKHVIIVSFVRSFTPKLGFL 995
Fly 996 NNERRLNV-LLSRPI--------SLLILIGNPRTLSQNSDFQHIIEMCRNRKTLVGEQYLNEDFI 1051
Fly 1052 TNK----------KTGANNVNKGGAAGDQPASGLRQPLK---------RKNHAKNPVQDAKIFYS 1097
Fly 1098 1097 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6701 | NP_001188923.1 | TIGR00376 | 424..1037 | CDD:273041 | 26/114 (23%) |
AAA_19 | 618..687 | CDD:289986 | |||
AAA_12 | 812..1019 | CDD:289832 | 22/96 (23%) | ||
CT55 | NP_001026875.1 | S1-like | 41..>78 | CDD:316926 | 9/38 (24%) |
S1-like | 182..233 | CDD:316926 | 6/18 (33%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 242..264 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165141439 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG1112 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.830 |