DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6701 and idi1

DIOPT Version :9

Sequence 1:NP_001188923.1 Gene:CG6701 / 36550 FlyBaseID:FBgn0033889 Length:1333 Species:Drosophila melanogaster
Sequence 2:XP_012820068.1 Gene:idi1 / 496783 XenbaseID:XB-GENE-492551 Length:280 Species:Xenopus tropicalis


Alignment Length:277 Identity:55/277 - (19%)
Similarity:95/277 - (34%) Gaps:97/277 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 PPINAGIKPPGT----------YANGMPRKPTVPWERELMGSFLLEMARL-----QVISAQTE-- 75
            |.::||::....          .:..||...|...:::.: ..|.||..|     |.|.|.|:  
 Frog    28 PGVSAGLRQSAAGKWQENSWQRNSRKMPEINTDSLDQQQV-MLLAEMCILINEDDQKIGADTKKN 91

  Fly    76 ----WYVDKAKMRKLFEVHLNALPNSSEIRQ----KLSSQGATNIGSLLHRTNFLINTPRGNPNY 132
                ..:||..:.:.|.|.|....|...::|    |::..|........|..|..:.|..||   
 Frog    92 CHLNSNIDKGLLHRAFSVFLFNSENKLLLQQRSEAKITFPGCYTNTCCSHPLNTPLETEEGN--- 153

  Fly   133 RIKNFSLMDFRKEKFNLLDEQHRLR---GIASTTDVPG----------GAPAEGNKPIIEEYKLD 184
                  .:..|:.      .|.||:   ||.....:|.          .|.::|   |..|:::|
 Frog   154 ------AIGVRRA------AQRRLKAELGIPMEQVMPDELKYLTRIHYKAQSDG---IWGEHEID 203

  Fly   185 TDVKPTLLKFQKRLLLQSDKDFELQSLGCYICQE------------------------------- 218
                 .:|..||.:.|..|.: |:|: .||:.:|                               
 Frog   204 -----YILFVQKDVALDPDPN-EIQT-HCYVSKEDLRQLLDKAKRGEVKITPWFQLIADTFLFKW 261

  Fly   219 --NFEKIEKYEEHVEYH 233
              |.:.::|:|:|.:.|
 Frog   262 WDNLQNLQKFEDHDQIH 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6701NP_001188923.1 TIGR00376 424..1037 CDD:273041
AAA_19 618..687 CDD:289986
AAA_12 812..1019 CDD:289832
idi1XP_012820068.1 Nudix_Hydrolase 65..280 CDD:294304 49/240 (20%)
Idi 72..261 CDD:224360 43/213 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165161511
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.