DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6701 and AgaP_AGAP011894

DIOPT Version :9

Sequence 1:NP_001188923.1 Gene:CG6701 / 36550 FlyBaseID:FBgn0033889 Length:1333 Species:Drosophila melanogaster
Sequence 2:XP_320632.3 Gene:AgaP_AGAP011894 / 1280766 VectorBaseID:AGAP011894 Length:147 Species:Anopheles gambiae


Alignment Length:117 Identity:20/117 - (17%)
Similarity:39/117 - (33%) Gaps:25/117 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 PTPIVSLSYQTCVDSHYFGFTLKTFRKDLVVDKFIIVQLRQFYYVYGAQMPLPVNGSGELVFFVD 313
            |.|:..::.:..:........::.|...:::       ||..|..|.....:.:.|.        
Mosquito    53 PKPVFRMTVEFSITQSMITIKVQNFCSQILI-------LRSIYLYYETSKRVVLFGG-------- 102

  Fly   314 SHVFMILREQPIVIGFTIQGEKYVEQHHFMRTEALPKASFNINPYRLSSKET 365
                 :||..|   |:....||.:.:........:..:.....||||  :||
Mosquito   103 -----VLRMVP---GYEFAMEKEIHEKEDRSYHVVFLSDLLGTPYRL--RET 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6701NP_001188923.1 TIGR00376 424..1037 CDD:273041
AAA_19 618..687 CDD:289986
AAA_12 812..1019 CDD:289832
AgaP_AGAP011894XP_320632.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000219
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.