DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PheRS-m and farsa

DIOPT Version :9

Sequence 1:NP_477283.1 Gene:PheRS-m / 36547 FlyBaseID:FBgn0275436 Length:453 Species:Drosophila melanogaster
Sequence 2:XP_012808632.1 Gene:farsa / 780288 XenbaseID:XB-GENE-946393 Length:563 Species:Xenopus tropicalis


Alignment Length:355 Identity:78/355 - (21%)
Similarity:126/355 - (35%) Gaps:128/355 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 STYATDGWTNVTPKILS--------YVGAN----------KHLQTDHPLSIIRQRIVNYFYGAYR 87
            ||..|...|::||::::        :.|.|          .||   |||..:|.:....|.    
 Frog   248 STSITKQETDLTPEMIASGSWREKQFKGYNFNALGVMPECGHL---HPLLKVRTQFRQIFL---- 305

  Fly    88 NQRGNPLFSVYDQMNPVVTVQQNFDNLLIPADHVSRQKSDCYYIN-------------------- 132
             :.|   |:.....|.:.:...|||.|..|..|.:|.:.|.:::.                    
 Frog   306 -EMG---FTEMPTNNFIESSFWNFDALFQPQQHPARDQHDTFFLQDPALATEFPMEYLEKVKKVH 366

  Fly   133 -------------------QQHLLRAHTTAHQVELI-------SGGLDNFLVVGEVYRRDEIDST 171
                               |:::||.||||....::       ......:..:..|:|.:.:|:|
 Frog   367 SEGGYGSQGYKYDWSIHEAQKNILRTHTTAVSARMLYKLAQQKEFSPVKYFSIDRVFRNETLDAT 431

  Fly   172 HYPVFHQADAVRLVTKDKLFERNPGLELFEETWSGTLADPKLILPSSKFMDQTKQPCHTLEAVKL 236
            |...|||.:                         |.:||..|.|  ...|...|:..|.|     
 Frog   432 HLAEFHQIE-------------------------GVVADRGLTL--GNLMGVLKEFFHKL----- 464

  Fly   237 MEHEMKHVLVGLTKDLFGPRIKYRWVDTYFPFTQPSWELEIYFK--DNWLEVLGCGIMRHEILQR 299
                      |:||..|.|        .|.|:|:||.|:..|.:  ..|:||...|:.|.|:|..
 Frog   465 ----------GITKLRFKP--------AYNPYTEPSMEVFSYHEGLQKWVEVGNSGLFRPELLLP 511

  Fly   300 SGVHQSIG-YAFGVGLERLAMVLFDIPDIR 328
            .|:.:.:. ..:|:.|||..|:.:.|.:||
 Frog   512 MGLPEDVNVLGWGLSLERPTMIRYGIKNIR 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PheRS-mNP_477283.1 pheS_mito 29..452 CDD:129561 78/355 (22%)
PheRS_alpha_core 69..334 CDD:238277 68/309 (22%)
FDX-ACB 356..453 CDD:214893
farsaXP_012808632.1 PLN02853 3..562 CDD:215458 78/355 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.