DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PheRS-m and fdxacb1

DIOPT Version :9

Sequence 1:NP_477283.1 Gene:PheRS-m / 36547 FlyBaseID:FBgn0275436 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_001093489.1 Gene:fdxacb1 / 566022 ZFINID:ZDB-GENE-030131-8403 Length:582 Species:Danio rerio


Alignment Length:434 Identity:94/434 - (21%)
Similarity:166/434 - (38%) Gaps:147/434 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 SYVGANKHLQTDHPLSIIRQRIVNYFYGAYRNQRGNPLFSVYDQMNPVVTVQQNFDNLL--IPA- 118
            :::|...|    ||:..:::::       :|.     |.||:    ||.|:.::|..|:  :|. 
Zfish   233 NFLGQQSH----HPVKTVQEQL-------HRE-----LKSVW----PVCTINEDFPELVYCLPEM 277

  Fly   119 ------------------------DHVSRQKSDCYYINQQ------HLLRAHTTAHQVELIS--- 150
                                    |....:::||...:.|      :.||.....|..|:..   
Zfish   278 LEACDPTLTHSEVYWIKPTDTYVFDQSETKQNDCESTDDQQSFTGSYALRPSLLLHVQEITQNED 342

  Fly   151 ---GGLDNFLVVGEVYRRDEIDSTHYPVFHQADAVRLVTKDKLFERNPGLELFEETWSGTLADPK 212
               |.|  :.|.|.|::|..|.....|.|||...|.:..    .|.:| |..|:::..      .
Zfish   343 FSPGTL--YAVSGLVFQRVPICPIRSPAFHQLLLVGMFP----VESHP-LRCFQDSLE------S 394

  Fly   213 LILPSSKFMDQTKQPCHTLEAVKLMEHEMKHVLVGLTKDLFGPRIKYRWVD----------TYFP 267
            |::|                    .:...:.|..||.:.:        |::          ||.|
Zfish   395 LLIP--------------------YDVSFEEVQTGLEQQV--------WINSKMLPKFGRITYLP 431

  Fly   268 FTQPSWELEIYFKDNWLEVLGCGIMRHEILQRSGVHQSIGYAFGVGLERLAMVLFDIPDIRLFWS 332
            ....:       .|..|:::                     |..|.|:.||.::|.|.|.||.||
Zfish   432 SISSA-------VDEGLQLV---------------------AVSVNLDHLATLIFGISDWRLLWS 468

  Fly   333 NDSGFLSQFSEKDLHNLPKYKPISHY-PQCTNDLSFWLPQDIEVDAGFSPNDFYDLVRSVAGDMV 396
            .|..||..|   :|.....:.|.|.| |...:|:|||:..:     .:...||:.:||..:..:|
Zfish   469 ADPRFLKHF---ELSPSGPFSPFSLYPPSYLHDISFWMDPE-----NYDELDFHAIVREASCGVV 525

  Fly   397 EQISLVDKFKHPKTGKSSVCFRIVYRHMERTLTQAEVNEIHKQI 440
            :.::|||:|:||..|.:|:|:|:.|:..:|.|:.::|..:..|:
Zfish   526 KNVALVDRFRHPHMGHASLCYRLTYQSSDRALSNSQVLALQNQL 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PheRS-mNP_477283.1 pheS_mito 29..452 CDD:129561 94/434 (22%)
PheRS_alpha_core 69..334 CDD:238277 59/313 (19%)
FDX-ACB 356..453 CDD:214893 27/86 (31%)
fdxacb1NP_001093489.1 DUF2431 8..177 CDD:287341
class_II_aaRS-like_core <437..477 CDD:294192 17/60 (28%)
FDX-ACB 489..582 CDD:214893 27/86 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.