DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PheRS-m and alpha-PheRS

DIOPT Version :9

Sequence 1:NP_477283.1 Gene:PheRS-m / 36547 FlyBaseID:FBgn0275436 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_572448.1 Gene:alpha-PheRS / 31740 FlyBaseID:FBgn0030007 Length:498 Species:Drosophila melanogaster


Alignment Length:346 Identity:77/346 - (22%)
Similarity:119/346 - (34%) Gaps:136/346 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 WTNVTPKILSY--VGA---NKHLQTDHPLSIIRQRIVNYFYGAYRNQRGNPLFSVYDQMNPVVTV 107
            |..:..|..::  :||   ..||   |||..:|......|.     :.|   ||.....|.|.:.
  Fly   201 WDQLKFKAYNFDALGAPPTRGHL---HPLLKVRTEFRQIFL-----EMG---FSEMPTNNYVESS 254

  Fly   108 QQNFDNLLIPADHVSRQKSDCYYIN---------------------------------------Q 133
            ..|||.|..|..|.:|...|.:::|                                       |
  Fly   255 FWNFDALYQPQQHPARDAHDTFFVNHPAKSHKFPQDYLERVKKVHSVGGYGSKGYGYDWKLEEAQ 319

  Fly   134 QHLLRAHTTAHQVELI------SGGLD--NFLVVGEVYRRDEIDSTHYPVFHQADAVRLVTKDKL 190
            ::|||.||||....::      .||..  .:..:.:|:|.:.:|:||...|||.:          
  Fly   320 KNLLRTHTTAVSARMLYKLANQEGGFKAAKYFSIDKVFRNETLDATHLAEFHQVE---------- 374

  Fly   191 FERNPGLELFEETWSGTLADPKLILPSSKFMDQTKQPCHTLEAVKLMEHEMKHVLVGLT-KDLFG 254
                           |.:||                                   |||| .||.|
  Fly   375 ---------------GVIAD-----------------------------------VGLTLGDLIG 389

  Fly   255 PRIKY---------RWVDTYFPFTQPSWELEIYFKD--NWLEVLGCGIMRHEILQRSGVHQSIG- 307
            ...::         .:...|.|:|:||.|:..|...  .|:||...|:.|.|:|...|:.:::. 
  Fly   390 TLYEFFRKLGITQLEFKPAYNPYTEPSMEIFCYHPGLAKWIEVGNSGVFRPEMLLPMGLPENVNV 454

  Fly   308 YAFGVGLERLAMVLFDIPDIR 328
            .|:|:.|||..|:.:.|.:||
  Fly   455 IAWGLSLERPTMIKYGINNIR 475

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PheRS-mNP_477283.1 pheS_mito 29..452 CDD:129561 77/346 (22%)
PheRS_alpha_core 69..334 CDD:238277 71/320 (22%)
FDX-ACB 356..453 CDD:214893
alpha-PheRSNP_572448.1 PLN02853 4..496 CDD:215458 77/346 (22%)
PheRS_alpha_core 224..483 CDD:238277 71/320 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460718
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0016
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11538
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.